PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_37058g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 309aa    MW: 34888.5 Da    PI: 6.0078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_37058g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-131966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l +++k +G g+W+  +++ g++R +k+c++rw++yl
    MA_37058g0010 19 RGAWTGSEDKILSEYIKTHGVGRWEDLPKKAGLKRGGKSCRLRWLNYL 66
                     89******************************99************97 PP

2Myb_DNA-binding53.27e-1772115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE+ell +++++lG++ W++Ia +++ gRt++++k++w++
    MA_37058g0010  72 RGNISPEEEELLFRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 115
                      7899******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8191466IPR017930Myb domain
SuperFamilySSF466891.03E-2716113IPR009057Homeodomain-like
SMARTSM007179.8E-121868IPR001005SANT/Myb domain
PfamPF002493.8E-121966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-212073IPR009057Homeodomain-like
CDDcd001673.48E-92166No hitNo description
PROSITE profilePS5129426.1467121IPR017930Myb domain
SMARTSM007172.9E-1671119IPR001005SANT/Myb domain
PfamPF002493.3E-1572116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-2574121IPR009057Homeodomain-like
CDDcd001672.60E-1276115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRSPSCSSC SKHEEGLHRG AWTGSEDKIL SEYIKTHGVG RWEDLPKKAG LKRGGKSCRL  60
RWLNYLRPDI KRGNISPEEE ELLFRLHRLL GNRWSLIAGR LPGRTDNEIK NYWNTQLSKR  120
VQLGEFEPRF QKPFKRRGIS SPSNDDEGGV VDKDNYASQT LPLKTRAVRY CGRALVDGGS  180
YDYDHVPDTH DGINQEEDLK AADDHVVEID TSKSWCQLLL EDCMGDYQND RLEAINGLQP  240
NPSNGTANPS NGTDDRHQSP SPSSNQSIIL QENHSSCNLI DQEFPHSKDF NSSYFDSFLD  300
LGELSNLVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1312180.0KU131218.1 Picea abies transcription factor MYB29 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047497.16e-65PREDICTED: myb-related protein 330-like
SwissprotQ9FJA27e-55TT2_ARATH; Transcription factor TT2
TrEMBLR4HES60.0R4HES6_PICAB; TT2-like protein
STRINGVIT_11s0016g01320.t015e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.15e-47MYB family protein